Receptor Grade IGF-1 LR3 for Sale: A Comprehensive Research Guide

The search for receptor grade IGF-1 LR3 for sale has grown significantly among researchers investigating insulin-like growth factor signaling pathways, cellular proliferation mechanisms, and tissue development biology. Receptor grade IGF-1 LR3, also known as Long R3 Insulin-like Growth Factor-1, is a synthetic analog of the naturally occurring 70-amino acid IGF-1 protein . This engineered variant contains an 83-amino acid structure featuring a 13-amino acid N-terminal extension and a substitution of arginine for glutamic acid at position 3 . This comprehensive guide provides researchers with essential information for those seeking receptor grade IGF-1 LR3 for sale, covering its chemical properties, mechanism of action, research applications, quality considerations, and regulatory status.

Understanding receptor grade IGF-1 LR3 for sale

Receptor grade IGF-1 LR3 is a synthetic polypeptide analog of human insulin-like growth factor-1 that has been specifically engineered for enhanced research applications . The designation “receptor grade” refers to the high purity level of the material, which is considered superior to media grade IGF-1 LR3 . This classification indicates that the product meets stringent quality standards suitable for receptor binding studies and other sensitive research applications.

The chemical properties of receptor grade IGF-1 LR3 include a molecular formula of C400H625N111O115S9 and a molecular weight of approximately 9117.5 g/mol . The peptide is typically supplied as a lyophilized white powder with purity specifications exceeding 98% to 99% when analyzed by SDS-PAGE and high-performance liquid chromatography . The amino acid sequence of receptor grade IGF-1 LR3 is MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA .

Proper storage of receptor grade IGF-1 LR3 at -20°C in a dry, desiccated environment protected from light is essential for maintaining peptide integrity . Upon reconstitution, the product should be stored at 4°C for up to one week or at -20°C for up to three months, with the addition of a carrier protein such as 0.1% BSA recommended for long-term storage . Repeated freeze-thaw cycles should be avoided to maintain peptide stability .

Mechanism of Action receptor grade IGF-1 LR3 for sale

Reduced IGF-Binding Protein Interaction

The key structural modification of receptor grade IGF-1 LR3 is its reduced affinity for insulin-like growth factor binding proteins (IGFBPs) . In the natural IGF-1 system, IGFBPs regulate the bioavailability and activity of IGF-1 by sequestering the growth factor and modulating its interaction with receptors . The engineered modifications in receptor grade IGF-1 LR3—specifically the arginine substitution at position 3 and the N-terminal extension—markedly decrease binding to IGFBPs, resulting in enhanced potency and extended availability in experimental systems .

This reduced binding to IGFBPs means that receptor grade IGF-1 LR3 is more readily available to interact with the type 1 IGF receptor, leading to increased biological activity compared to native IGF-1 . The enhanced potency is attributed to the decreased sequestration by binding proteins that normally inhibit the biological actions of IGFs .

IGF-1 Receptor Activation receptor grade IGF-1 LR3 for sale

Receptor grade IGF-1 LR3 binds to the type 1 IGF receptor with affinity similar to wild-type IGF-1 . Upon receptor binding, it initiates intracellular signaling cascades, including the PI3K/Akt and MAPK/ERK pathways, which are involved in cellular proliferation, differentiation, and metabolic regulation . This signaling pathway activation makes receptor grade IGF-1 LR3 a useful probe for isolating receptor-specific signaling events without confounding sequestration by endogenous binding proteins .

The increased potency of receptor grade IGF-1 LR3 is due to reduced binding to most IGF binding proteins, which normally modify the biological actions of IGF-1 . This property allows researchers to study IGF-1 receptor-mediated signaling with greater specificity and reduced interference from the IGFBP regulatory system.

Research Applications receptor grade IGF-1 LR3 for sale

Cellular Proliferation and Survival Studies

Receptor grade IGF-1 LR3 is utilized as a research reagent for investigating IGF-1 receptor-mediated signal transduction, cellular proliferation pathways, and survival signaling networks in in-vitro and preclinical animal models . The peptide has been shown to stimulate the proliferation and survival of various cell types, including muscle, bone, and cartilage tissue . Researchers investigating growth factor signaling, cell cycle regulation, and apoptosis may find receptor grade IGF-1 LR3 a valuable research tool.

Tissue Development and Organ Growth Research receptor grade IGF-1 LR3 for sale

Receptor grade IGF-1 LR3 has been investigated for its potential to promote tissue and organ-specific growth . Experimental infusion of IGF-1 analogs, including LR3 IGF-1, into animal models has been shown to increase organ growth and skeletal muscle myoblast proliferation . Researchers studying tissue development, organ growth, and regenerative processes may utilize receptor grade IGF-1 LR3 to explore IGF-1 signaling pathways.

Receptor Kinetics and Binding Studies  

Receptor grade IGF-1 LR3 is utilized in studies examining IGF receptor kinetics, growth factor signaling, and peptide-receptor interactions under controlled laboratory conditions . The peptide’s reduced affinity for IGFBPs makes it particularly useful for isolating and studying receptor-specific binding events. Researchers investigating receptor-ligand interactions, binding affinity, and signaling kinetics may find receptor grade IGF-1 LR3 a valuable tool for their experiments.

Quality Considerations When You Buy receptor grade IGF-1 LR3 for sale

Purity Standards

When researchers decide to buy receptor grade IGF-1 LR3, purity standards are paramount. Receptor grade IGF-1 LR3 should demonstrate minimum purity specifications of at least 95% when analyzed by SDS-PAGE and HPLC . Many suppliers offer products with purity exceeding 98% to 99% . The designation “receptor grade” indicates a higher purity level than media grade IGF-1 LR3 .

Biological Activity Verification

When evaluating receptor grade IGF-1 LR3 for sale, researchers should verify the product’s biological activity. Biological activity is typically measured using cell proliferation assays. For example, the ED50 for receptor grade IGF-1 LR3 is typically less than 10.0 ng/ml, as measured by the dose-dependent proliferation of CHO cells, corresponding to a specific activity greater than 1.0 × 10⁵ units/mg . Some products demonstrate an ED50 of 0.3-1.5 ng/ml in human MCF-7 cell proliferation assays .

Documentation Requirements

Legitimate suppliers offering receptor grade IGF-1 LR3 for sale should provide batch-specific Certificates of Analysis documenting identity, purity by SDS-PAGE and HPLC, biological activity, endotoxin levels, and appearance testing . Endotoxin levels should be less than 1 EU/μg of protein by gel clotting method . The product should be supplied as a sterile filtered lyophilized powder .

Regulatory Status and Legal Considerations receptor grade IGF-1 LR3 for sale

Receptor grade IGF-1 LR3 is classified as a research-use-only product for laboratory investigations . These compounds are not approved for human use outside of clinical trials and are intended exclusively for in-vitro and preclinical research applications . Researchers who buy receptor grade IGF-1 LR3 must ensure compliance with all applicable regulations regarding the acquisition, handling, and use of research peptides in their jurisdiction.

Conclusion receptor grade IGF-1 LR3 for sale

Receptor grade IGF-1 LR3 represents a significant research reagent across multiple scientific disciplines, from cellular proliferation and signal transduction studies to tissue development and organ growth research. Its unique structural modifications—including the arginine substitution at position 3 and the N-terminal extension—result in reduced affinity for IGF binding proteins and enhanced biological potency, making it a valuable tool for investigating IGF-1 receptor-mediated signaling.

For researchers looking to buy receptor grade IGF-1 LR3, understanding the compound’s chemical properties, quality requirements, and research applications is essential. High-purity receptor grade IGF-1 LR3, stored and handled properly, provides a valuable reagent for investigating fundamental biological processes. When evaluating suppliers from whom to buy receptor grade IGF-1 LR3, researchers should prioritize those that provide comprehensive quality documentation, including purity verification, biological activity confirmation, and endotoxin testing, to ensure experimental reproducibility and scientific validity. As the field of growth factor research advances, receptor grade IGF-1 LR3 will undoubtedly continue to contribute to our understanding of IGF-1 signaling and its role in cellular proliferation, differentiation, and tissue development.