LL-37 Peptide for Sale: A Comprehensive Research Guide
The search for LL-37 peptide for sale has grown significantly as researchers investigate this multifunctional antimicrobial peptide. LL-37 is the only human cathelicidin antimicrobial peptide, playing a critical role in the innate immune system through its broad-spectrum antimicrobial activity and diverse immunomodulatory functions. This comprehensive guide provides researchers with essential information about LL-37 peptide research applications, quality considerations, and pricing factors for those seeking LL-37 peptide for sale.
Understanding LL-37 Peptide
LL-37 is a 37-amino acid peptide with a molecular weight of approximately 4493-4553 g/mol, depending on the specific salt form. The peptide sequence is [LL-37, 37 aa] The name “LL-37” reflects its structure, starting with two leucine residues and having a total length of 37 amino acids. This cationic and amphipathic peptide can adopt an alpha-helical structure under specific conditions, which is essential for its antimicrobial activity.
LL-37 is classified as a host defense peptide, a class of molecules that are increasingly recognized for their broad biological activities beyond direct antimicrobial effects. The peptide is derived from the cathelicidin protein hCAP-18, which is stored in neutrophil granules and secreted by various epithelial cells. Proteolytic processing releases the active LL-37 peptide from its precursor, allowing it to participate in immune responses at sites of infection and inflammation.
Mechanism of Action and Research Applications LL-37 peptide for sale
Antimicrobial Activity
LL-37 exhibits potent antimicrobial activity against a wide range of pathogens. The peptide’s mechanism involves disruption of microbial membranes through its amphipathic structure, leading to cell lysis and death. Research has demonstrated that LL-37 is effective against gram-positive bacteria, gram-negative bacteria, fungi, and certain viruses.
The peptide’s cationic nature allows it to interact with negatively charged microbial membranes, while its amphipathic structure enables insertion and disruption of the lipid bilayer. This mechanism differs significantly from traditional antibiotics, making LL-37 an interesting subject for research into novel antimicrobial strategies, particularly in the context of antibiotic resistance.
Immunomodulatory Functions
Beyond its direct antimicrobial effects, LL-37 is a potent immunomodulator. The peptide can influence both innate and adaptive immune responses through various mechanisms. LL-37 has been shown to modulate the expression of cytokines and chemokines, influencing the recruitment and activation of immune cells.
Research indicates that LL-37 can promote the migration of various immune cells, including neutrophils, monocytes, and T cells, to sites of infection or tissue damage. Additionally, LL-37 has been demonstrated to modulate the differentiation of dendritic cells and influence their ability to present antigens, suggesting a role in linking innate and adaptive immunity.
Wound Healing and Tissue Repair LL-37 peptide for sale
LL-37 has been investigated for its role in wound healing and tissue repair. The peptide can stimulate the proliferation and migration of epithelial cells, which is essential for re-epithelialization during wound closure. LL-37 also promotes angiogenesis, the formation of new blood vessels, which is critical for delivering oxygen and nutrients to healing tissues.
Furthermore, LL-37 can modulate the inflammatory response at wound sites, potentially preventing excessive inflammation that could impair healing. These properties make LL-37 a compound of interest for researchers studying wound healing, tissue regeneration, and chronic wound management.
Inflammatory and Autoimmune Research LL-37 peptide for sale
The immunomodulatory properties of LL-37 have led to investigations into its role in inflammatory and autoimmune conditions. Dysregulation of LL-37 expression has been observed in various diseases, including psoriasis, rosacea, and systemic lupus erythematosus.
In psoriasis, LL-37 can bind to self-DNA, forming complexes that activate plasmacytoid dendritic cells and stimulate production of type I interferons, contributing to the inflammatory cascade. Understanding this mechanism has provided insights into psoriasis pathogenesis and potential therapeutic targets. In other conditions, LL-37 may have protective effects, highlighting its complex and context-dependent roles in immune regulation.
Cancer Research
Emerging research has explored the role of LL-37 in cancer biology. The peptide has demonstrated both pro-tumor and anti-tumor effects depending on the context, making it a complex and intriguing subject for investigation.
In some cancer types, LL-37 can promote tumor growth by stimulating angiogenesis and modulating the immune microenvironment. In others, it may exert direct anti-tumor effects by inducing apoptosis or inhibiting cell proliferation. These findings highlight the need for further research to elucidate the precise mechanisms and contextual factors that determine LL-37’s effects in different cancer models.
Quality Considerations for Research Peptides
Purity Standards and Analytical Verification LL-37 peptide for sale
For those seeking LL-37 peptide for sale for research purposes, quality standards are essential. Research-grade LL-37 should demonstrate minimum purity specifications of at least 98% when analyzed by high-performance liquid chromatography. Many suppliers require a minimum 99% purity specification enforced at the batch level, with release contingent on verified analytical conformance.
High-purity research peptides are critical for experimental reproducibility. Impurities from synthesis, such as truncated sequences, deletion products, or oxidation byproducts, can confound experimental results and lead to unreliable data. Researchers seeking LL-37 peptide for sale should prioritize suppliers that provide comprehensive analytical documentation.
The certificate of analysis for research-grade LL-37 should include identity confirmation by mass spectrometry, purity by HPLC, sequence confirmation, and appearance testing. Additional testing may include residual solvent analysis, water content, acetate content, peptide content, endotoxin testing, and microbial limit testing.
Documentation Requirements LL-37 peptide for sale
Legitimate suppliers providing LL-37 peptide for sale should offer batch-specific Certificates of Analysis containing HPLC chromatograms and mass spectrometry identity confirmation. Third-party lab accreditation and pre-purchase document access are indicators of reliable sourcing. Researchers should verify that these documents are available before completing any transaction.
Documentation should include detailed information about peptide content, counterion presence, and storage recommendations. The peptide content, typically comprising more than 80% of the total weight, affects accurate dosing calculations in research protocols.
Storage and Handling
LL-37 is typically supplied as a lyophilized powder, which helps preserve peptide stability during storage and transportation. Proper storage is essential for maintaining peptide integrity. Researchers should store lyophilized LL-37 at -20°C in a dry, desiccated environment protected from light. Upon reconstitution, the peptide should be stored at 4°C and used within a short timeframe to prevent loss of potency.
Repeated freeze-thaw cycles should be avoided to maintain peptide stability. Preparing aliquots of reconstituted LL-37 for single-use applications preserves compound integrity over extended research periods. Proper handling protocols ensure that experimental results reflect genuine biological phenomena rather than artifacts of degraded research materials.
Pricing and Market Considerations LL-37 peptide for sale
Factors Influencing LL-37 Pricing
Several factors influence LL-37 pricing for research applications. The scale of manufacture is a primary determinant, with per-unit production costs declining as peptide synthesis volumes increase. Quality control rigor also affects pricing, as comprehensive testing including HPLC purity analysis and mass spectrometry verification adds to manufacturing costs.
Documentation standards influence pricing, with suppliers providing batch-specific certificates of analysis and third-party verification typically charging premium prices. This documentation provides researchers with confidence in compound integrity and supports experimental reproducibility.
Volume Discounts and Bulk Purchasing LL-37 peptide for sale
For laboratories with ongoing research programs, LL-37 pricing becomes more favorable through volume purchasing. Many suppliers offer tiered discount structures that reduce the per-unit cost for larger orders. Researchers planning extended studies should consider these discounts when calculating overall research costs.
The economy of scale effect means that larger quantities consistently offer lower per-milligram rates, making bulk purchasing a cost-effective strategy for well-funded research programs. Researchers should factor lead times into their procurement strategies, as larger quantities may require extended production schedules.
Regional Price Variations
LL-37 pricing may vary across regions due to local market conditions, regulatory requirements, and distribution costs. Researchers in different geographic locations may encounter different pricing structures. When comparing LL-37 peptide for sale options, researchers should factor in shipping costs, customs fees, and import duties to determine the total acquisition cost.
Regulatory Status and Legal Considerations
LL-37 peptide for sale for research purposes is classified as a research-use-only product. These compounds are not approved for human use outside of clinical trials and are intended exclusively for in-vitro laboratory research. Researchers must ensure compliance with all applicable regulations regarding the acquisition, handling, and use of research peptides in their jurisdiction.
The peptide’s role in immune regulation has implications for its research applications, but it remains an investigational compound not approved for therapeutic use. Researchers should maintain awareness of evolving regulations governing antimicrobial peptides and host defense peptides.
Conclusion
LL-37 peptide for sale represents a significant research investment across multiple scientific disciplines, from antimicrobial and immunological studies to wound healing and cancer research. Its unique mechanism of action as the only human cathelicidin, combining direct antimicrobial activity with diverse immunomodulatory functions, makes it a valuable research tool for investigating innate immunity and host defense mechanisms.
For researchers acquiring LL-37, understanding the compound’s chemical properties, quality requirements, and pricing factors is essential. High-purity research-grade LL-37, stored and handled properly, provides a valuable tool for investigating fundamental biological processes. When evaluating suppliers, researchers should prioritize those that provide comprehensive quality documentation, including HPLC purity verification and mass spectrometry confirmation, to ensure experimental reproducibility and scientific validity.
The research applications of LL-37 continue to expand as understanding of host defense peptides deepens. From antimicrobial resistance and wound healing to inflammatory diseases and cancer biology, LL-37 remains a compound of significant interest for researchers committed to scientific discovery.












Reviews
There are no reviews yet.